Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC25A39 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-250 of human SLC25A39 (NP_001137252.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SLC25A39 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-250 of human SLC25A39 (NP_001137252.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05046A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC25A39 |
| Target Synonyms | CGI69; CGI-69; SLC25A39 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 170-250 of human SLC25A39 (NP_001137252.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LARLGTVTVISPLELMRTKLQAQHVSYRELGACVRTAVAQGGWRSLWLGWGPTALRDVPFSALYWFNYELVKSWLNGFRPK | Uniprot ID | Q9BZJ4 |
Uniprot Id
Q9BZJ4
Target Species
Human
Target Name
SLC25A39
Target Full Name
Mitochondrial glutathione transporter SLC25A39
Target Function
Required for normal heme biosynthesis.
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
Mitochondrial carrier (TC 2.A.29) family
Target Tissue Specificity
Expressed in many tissues. Abundant in testis and kidney.
Target Synonyms
SLC25A39; CGI-69; PRO2163; Solute carrier family 25 member 39
Target Background
This gene encodes a member of the SLC25 transporter or mitochondrial carrier family of proteins. Members of this family are encoded by the nuclear genome while their protein products are usually embedded in the inner mitochondrial membrane and exhibit wide-ranging substrate specificity. Although the encoded protein is currently considered an orphan transporter, this protein is related to other carriers known to transport amino acids. This protein may play a role in iron homeostasis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
