Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC26A11 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human SLC26A11 (NP_001159819.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC26A11 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human SLC26A11 (NP_001159819.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02080A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC26A11 |
| Target Synonyms | SLC26A11 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 500-600 of human SLC26A11 (NP_001159819.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDFQKQGVALAFVGLQVPVLRVLLSADLKGFQYFSTLEEAEKHLRQEPGTQPYNIREDSILDQK | Uniprot ID | Q86WA9 |
Uniprot Id
Q86WA9
Target Species
Human
Target Name
SLC26A11
Target Full Name
Sodium-independent sulfate anion transporter
Target Function
Exhibits sodium-independent sulfate anion transporter activity that may cooperate with SLC26A2 to mediate DIDS-sensitive sulfate uptake into high endothelial venules endothelial cells (HEVEC).
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.
Target Protein Families
SLC26A/SulP transporter (TC 2.A.53) family
Target Tissue Specificity
Detected in all tissues tested with highest expression observed in brain, kidney, HEVEC and placenta and lowest in pancreas, skeletal muscle, liver, lung and heart.
Target Synonyms
SLC26A11; Sodium-independent sulfate anion transporter; Solute carrier family 26 member 11
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
