Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC26A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human SLC26A2 (NP_000103.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC26A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human SLC26A2 (NP_000103.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05569A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC26A2 |
| Target Synonyms | DTD; EDM4; DTDST; MST153; D5S1708; MSTP157; SLC26A2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Jurkat, Mouse testis, Rat intestine, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human SLC26A2 (NP_000103.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQEKSDTNFKEFVIKKLQKNCQCSPAKAKNMILGFLPVLQWLPKYDLKKNILGD | Uniprot ID | P50443 |
Uniprot Id
P50443
Target Species
Human
Target Name
SLC26A2
Target Full Name
Sulfate transporter
Target Function
Sulfate transporter. May play a role in endochondral bone formation.
Target Involvement
Diastrophic dysplasia (DTD); Achondrogenesis 1B (ACG1B); Atelosteogenesis 2 (AO2); Multiple epiphyseal dysplasia 4 (EDM4)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
SLC26A/SulP transporter (TC 2.A.53) family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
SLC26A2; DTD; DTDST; Sulfate transporter; Diastrophic dysplasia protein; Solute carrier family 26 member 2
Target Background
The diastrophic dysplasia sulfate transporter is a transmembrane glycoprotein implicated in the pathogenesis of several human chondrodysplasias. It apparently is critical in cartilage for sulfation of proteoglycans and matrix organization.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
