-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC27A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 510-646 of human SLC27A1 (NP_940982.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SLC27A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 510-646 of human SLC27A1 (NP_940982.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11814A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC27A1 |
| Target Synonyms | FATP; FATP1; ACSVL5; FATP-1; SLC27A1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 510-646 of human SLC27A1 (NP_940982.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DTFRWRGENVSTTEVEGVLSRLLGQTDVAVYGVAVPGVEGKAGMAAVADPHSLLDPNAIYQELQKVLAPYARPIFLRLLPQVDTTGTFKIQKTRLQREGFDPRQTSDRLFFLDLKQGHYLPLNEAVYTRICSGAFAL | Uniprot ID | Q6PCB7 |
Uniprot Id
Q6PCB7
Target Species
Human
Target Name
SLC27A1
Target Full Name
Long-chain fatty acid transport protein 1
Target Function
Mediates the ATP-dependent import of long-chain fatty acids (LCFA) into the cell by mediating their translocation at the plasma membrane. Has also an acyl-CoA ligase activity for long-chain and very-long-chain fatty acids. May act directly as a bona fide transporter, or alternatively, in a cytoplasmic or membrane-associated multimeric protein complex to trap and draw fatty acids towards accumulation. Plays a pivotal role in regulating available LCFA substrates from exogenous sources in tissues undergoing high levels of beta-oxidation or triglyceride synthesis. May be involved in regulation of cholesterol metabolism. Probably involved in fatty acid transport across the blood barrier.
Target Subcellular Location
Cell membrane; Single-pass membrane protein. Endomembrane system; Single-pass membrane protein. Cytoplasm.
Target Protein Families
ATP-dependent AMP-binding enzyme family
Target Tissue Specificity
Highest levels of expression are detected in muscle and adipose tissue small, intermediate levels in small intestine, and barely detectable in liver. Expressed in brain gray matter.
Target Synonyms
SLC27A1; ACSVL5; FATP1Long-chain fatty acid transport protein 1; FATP-1; Fatty acid transport protein 1; EC 6.2.1.-; Solute carrier family 27 member 1
Target Background
Enables biotin transmembrane transporter activity; efflux transmembrane transporter activity; and long-chain fatty acid transporter activity. Involved in several processes, including carboxylic acid transmembrane transport; glycerophospholipid biosynthetic process; and lipid transport across blood-brain barrier. Located in membrane. Part of plasma membrane.
Notification