-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC29A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SLC29A3 (NP_060814.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC29A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SLC29A3 (NP_060814.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01464A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC29A3 |
| Target Synonyms | ENT3; HJCD; PHID; HCLAP; SLC29A3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, A-549, HT-29, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SLC29A3 (NP_060814.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAVVSEDDFQHSSNSTYRTTSSSLRADQEALLEKLLDRPPPGLQRPEDRFCGTYIIFFSLGIGSLLPWNFFITAKEYWMFKLRNSSSPATGEDPEGSDILNYFESYLAVA | Uniprot ID | Q9BZD2 |
Uniprot Id
Q9BZD2
Target Species
Human
Target Name
SLC29A3
Target Full Name
Equilibrative nucleoside transporter 3
Target Function
Mediates both influx and efflux of nucleosides across the membrane (equilibrative transporter). Mediates transport of adenine, adenosine and uridine, as well as several nucleoside analog drugs, such as anticancer and antiviral agents, including cladribine, cordycepin, tubercidin and AZT. Does not transport hypoxanthine.
Target Involvement
Histiocytosis-lymphadenopathy plus syndrome (HLAS)
Target Subcellular Location
Membrane; Multi-pass membrane protein. Late endosome membrane. Lysosome membrane. Note=Observed in a punctate intracellular pattern showing partial colocalization with late endosomes/lysosomes. Not detected at the cell surface.
Target Protein Families
SLC29A/ENT transporter (TC 2.A.57) family
Target Tissue Specificity
Widely expressed in both adult and fetal tissues. Highest levels in placenta, uterus, ovary, spleen, lymph node and bone marrow. Lowest levels in brain and heart.
Target Synonyms
ENT3; Equilibrative nucleoside transporter 3; HCLAP; hENT3; HJCD; PHID; S29A3_HUMAN; SLC29A3; Solute carrier family 29 (equilibrative nucleoside transporter) member 3; Solute carrier family 29 (nucleoside transporters) member 3; Solute carrier family 29 member 3
Target Background
This gene encodes a nucleoside transporter. The encoded protein plays a role in cellular uptake of nucleosides, nucleobases, and their related analogs. Mutations in this gene have been associated with H syndrome, which is characterized by cutaneous hyperpigmentation and hypertrichosis, hepatosplenomegaly, heart anomalies, and hypogonadism. A related disorder, PHID (pigmented hypertrichosis with insulin-dependent diabetes mellitus), has also been associated with mutations at this locus. Alternatively spliced transcript variants have been described.
Notification