Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC2A4RG was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human SLC2A4RG (NP_064446.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC2A4RG was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human SLC2A4RG (NP_064446.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06361A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC2A4RG |
| Target Synonyms | GEF; HDBP1; HDBP-1; Si-1-2; Si-1-2-19; SLC2A4RG | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SLC2A4RG (NP_064446.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ARLDEVMAAAALTSLSTSPLLLGAPVAAFSPEPGLEPWKEALVRPPGSYSSSSNSGDWGWDLASDQSSPSTPSPPLPPEAAHFLFGEPTLRKRKSPAQVMF | Uniprot ID | Q9NR83 |
Uniprot Id
Q9NR83
Target Species
Human
Target Name
SLC2A4RG
Target Full Name
SLC2A4 regulator
Target Function
Transcription factor involved in SLC2A4 and HD gene transactivation. Binds to the consensus sequence 5'-GCCGGCG-3'.
Target Subcellular Location
Cytoplasm. Nucleus. Note=Shuttles between the cytoplasm and the nucleus.
Target Tissue Specificity
According to PubMed:14630949, expressed in heart, skeletal muscle, liver, kidney and pancreas; undetectable in lung, placenta or brain. According to PubMed:14625278, ubiquitously expressed, with lowest expression in brain and ileum.
Target Synonyms
GEF; GLUT4 enhancer factor; HDBP 1; HDBP-1; HDBP1; Huntington disease gene regulatory region binding protein 1; Huntington disease gene regulatory region-binding protein 1; S2A4R_HUMAN; Si 1 2 19; Si 1 2; SLC2A4 regulator; SLC2A4RG; Zinc finger protein 2 5 Glut4 enhancer factor
Target Background
The protein encoded by this gene is a nuclear transcription factor involved in the activation of the solute carrier family 2 member 4 gene. The encoded protein interacts with another transcription factor, myocyte enhancer factor 2, to activate transcription of this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
