-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC34A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human SLC34A3 (NP_063949.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC34A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human SLC34A3 (NP_063949.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00557A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC34A3 |
| Target Synonyms | HHRH; NPT2C; NPTIIc; SLC34A3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human SLC34A3 (NP_063949.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD | Uniprot ID | Q8N130 |
Uniprot Id
Q8N130
Target Species
Human
Target Name
SLC34A3
Target Full Name
Sodium-dependent phosphate transport protein 2C
Target Function
May be involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane. Probably mediates 20-30% of the apical influx.
Target Involvement
Hereditary hypophosphatemic rickets with hypercalciuria (HHRH)
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
SLC34A transporter family
Target Synonyms
HHRH ; Na(+) dependent phosphate cotransporter 2C ; Na(+) Pi cotransporter 2C; Na(+)-dependent phosphate cotransporter 2C; Na(+)/Pi cotransporter 2C; NaPi 2c; NaPi-2c; NPT2C ; NPT2C_HUMAN; NPTIIC ; SLC34A3; Sodium dependent phosphate transport protein 2C; Sodium inorganic phosphate cotransporter IIC; Sodium phosphate cotransporter 2C; Sodium phosphate transport protein 2C ; Sodium-dependent phosphate transport protein 2C; Sodium-phosphate transport protein 2C; Sodium/inorganic phosphate cotransporter IIC; Sodium/inorganic phosphate cotransporter; type IIC; Sodium/phosphate cotransporter 2C; solute carrier family 34 (sodium phosphate) member 3; solute carrier family 34 (sodium/phosphate contransporter); member 3; solute carrier family 34 (type II sodium/phosphate contransporter); member 3; Solute carrier family 34 member 3; type IIc Na+ Pi cotransporter ; Type IIc Na+/Pi cotransporter
Target Background
This gene encodes a member of SLC34A transporter family of proteins, and is expressed primarily in the kidney. It is involved in transporting phosphate into cells via sodium cotransport in the renal brush border membrane, and contributes to the maintenance of inorganic phosphate concentration in the kidney. Mutations in this gene are associated with hereditary hypophosphatemic rickets with hypercalciuria. Alternatively spliced transcript variants varying in the 5' UTR have been found for this gene.
Notification