-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC38A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human SLC38A1 (NP_001070952.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC38A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human SLC38A1 (NP_001070952.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07539A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC38A1 |
| Target Synonyms | ATA1; NAT2; SAT1; SNAT1; SLC38A1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, A-549 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human SLC38A1 (NP_001070952.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMHFKSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEKKKCDEYIPGT | Uniprot ID | Q9H2H9 |
Uniprot Id
Q9H2H9
Target Species
Human
Target Name
SLC38A1
Target Full Name
Sodium-coupled neutral amino acid symporter 1
Target Function
Functions as a sodium-dependent amino acid transporter. Mediates the saturable, pH-sensitive and electrogenic cotransport of glutamine and sodium ions with a stoichiometry of 1:1. May also transport small zwitterionic and aliphatic amino acids with a lower affinity. May supply glutamatergic and GABAergic neurons with glutamine which is required for the synthesis of the neurotransmitters glutamate and GABA.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Amino acid/polyamine transporter 2 family
Target Tissue Specificity
Expressed in the cerebral cortex by pyramidal and GABAergic neurons, astrocytes and other non-neuronal cells (at protein level). Expressed in placenta, heart, lung, skeletal muscle, spleen, stomach and testis.
Target Synonyms
Amino acid transporter A1; Amino acid transporter system A1; ATA 1; ATA1; N-system amino acid transporter 2; NAT 2; NAT2; S38A1_HUMAN; SAT 1; SAT1; SLC38A1; SNAT 1; SNAT1; Sodium-coupled neutral amino acid transporter 1; Solute carrier family 38 member 1; System A amino acid transporter 1; System N amino acid transporter 1
Target Background
Amino acid transporters play essential roles in the uptake of nutrients, production of energy, chemical metabolism, detoxification, and neurotransmitter cycling. SLC38A1 is an important transporter of glutamine, an intermediate in the detoxification of ammonia and the production of urea. Glutamine serves as a precursor for the synaptic transmitter, glutamate (Gu et al., 2001 [PubMed 11325958]).
Notification