-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC44A4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 65-215 of human SLC44A4 (NP_079533.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC44A4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 65-215 of human SLC44A4 (NP_079533.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10924A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC44A4 |
| Target Synonyms | CTL4; NG22; TPPT; DFNA72; hTPPT1; C6orf29; SLC44A4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, HT-29, K-562, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 65-215 of human SLC44A4 (NP_079533.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LYPRNSTGAYCGMGENKDKPYLLYFNIFSCILSSNIISVAENGLQCPTPQVCVSSCPEDPWTVGKNEFSQTVGEVFYTKNRNFCLPGVPWNMTVITSLQQELCPSFLLPSAPALGRCFPWTNVTPPALPGITNDTTIQQGISGLIDSLNAR | Uniprot ID | Q53GD3 |
Uniprot Id
Q53GD3
Target Species
Human
Target Name
SLC44A4
Target Full Name
Choline transporter-like protein 4
Target Function
Choline transporter that plays a role in the choline-acetylcholine system and is required to the efferent innervation of hair cells in the olivocochlear bundle for the maintenance of physiological function of outer hair cells and the protection of hair cells from acoustic injury. Also described as a thiamine pyrophosphate transporter in colon, may mediate the absorption of microbiota-generated thiamine pyrophosphate and contribute to host thiamine (vitamin B1) homeostasis.; Has also thiamine pyrophosphate transporter activity.
Target Involvement
Deafness, autosomal dominant, 72 (DFNA72)
Target Subcellular Location
Membrane; Multi-pass membrane protein. Apical cell membrane.
Target Protein Families
CTL (choline transporter-like) family
Target Tissue Specificity
Highly expressed in colon, also detected in prostate, trachea and lung. Isoform 3 is also expressed in colon but a lower levels.
Target Research Area
Others
Target Synonyms
C6orf29; Choline transporter-like protein 4; CTL4; CTL4_HUMAN; NG22; Slc44a4; Solute carrier family 44 member 4; UNQ441/PRO874
Target Background
The protein encoded by this gene may be a sodium-dependent transmembrane transport protein involved in the uptake of choline by cholinergic neurons. Defects in this gene can cause sialidosis, a lysosomal storage disease. Three transcript variants encoding different isoforms have been found for this gene.
Notification