Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC46A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SLC46A2 (NP_149040.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC46A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SLC46A2 (NP_149040.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05014A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC46A2 |
| Target Synonyms | Ly110; TSCOT; SLC46A2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, LO2, MCF7, Mouse brain, Mouse spleen, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SLC46A2 (NP_149040.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSPEVTCPRRGHLPRFHPRTWVEPVVASSQVAASLYDAGLLLVVKASYGTGGSSNHSASPSPRGALEDQQQRAISNFYIIYNLVVGLSPLLSAYGLGWLSDRYHRKISIC | Uniprot ID | Q9BY10 |
Uniprot Id
Q9BY10
Target Species
Human
Target Name
SLC46A2
Target Full Name
Solute carrier family 46 member 2
Target Function
May act as a transporter.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Major facilitator superfamily, SLC46A family
Target Tissue Specificity
Strongly expressed in the adult thymus. Expressed in spleen, lymph nodes, thymus, PBL, bone marrow and fetal liver.
Target Synonyms
SLC46A2; TSCOT; Thymic stromal cotransporter homolog; Solute carrier family 46 member 2
Target Background
Predicted to enable transmembrane transporter activity. Involved in positive regulation of nucleotide-binding activity oligomerization domain containing 1 signaling pathway. Predicted to be located in cell surface and plasma membrane. Predicted to be integral component of membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
