-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC5A7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 503-580 of human SLC5A7 (NP_068587.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SLC5A7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 503-580 of human SLC5A7 (NP_068587.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06832A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC5A7 |
| Target Synonyms | CHT; CHT1; CMS20; HMN7A; DHMNVP; SLC5A7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, Rat brain, Mouse brain, SGC-7901, SH-SY5Y, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 503-580 of human SLC5A7 (NP_068587.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLDELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNLQ | Uniprot ID | Q9GZV3 |
Uniprot Id
Q9GZV3
Target Species
Human
Target Name
SLC5A7
Target Full Name
High affinity choline transporter 1
Target Function
Transmembrane transporter that imports choline from the extracellular space into the neuron with high affinity. Choline uptake is the rate-limiting step in acetylcholine synthesis. Sodium ion- and chloride ion-dependent.
Target Involvement
Neuronopathy, distal hereditary motor, 7A (HMN7A); Myasthenic syndrome, congenital, 20, presynaptic (CMS20)
Target Subcellular Location
Membrane; Multi-pass membrane protein. Cell membrane. Cell junction, synapse.
Target Protein Families
Sodium:solute symporter (SSF) (TC 2.A.21) family
Target Tissue Specificity
Expressed in putamen, spinal cord and medulla. Specific for cholinergic neurons.
Target Synonyms
SLC5A7; CHT1; High affinity choline transporter 1; Hemicholinium-3-sensitive choline transporter; CHT; Solute carrier family 5 member 7
Target Background
This gene encodes a sodium ion- and chloride ion-dependent high-affinity transporter that mediates choline uptake for acetylcholine synthesis in cholinergic neurons. The protein transports choline from the extracellular space into presynaptic terminals for synthesis into acetylcholine. Increased choline uptake results from increased density of this protein in synaptosomal plasma membranes in response to depolarization of cholinergic terminals. Dysfunction of cholinergic signaling has been implicated in various disorders including depression, attention-deficit disorder, and schizophrenia. An allelic variant of this gene is associated with autosomal dominant distal hereditary motor neuronopathy type VIIA. Alternative splicing results in multiple transcript variants.
Notification