Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC5A9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 230-320 of human SLC5A9 (NP_001011547.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC5A9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 230-320 of human SLC5A9 (NP_001011547.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05333A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC5A9 |
| Target Synonyms | SGLT4; SLC5A9 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, LO2, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 230-320 of human SLC5A9 (NP_001011547.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LGFQDVGWYPGLEQRYRQAIPNVTVPNTTCHLPRPDAFHILRDPVSGDIPWPGLIFGLTVLATWCWCTDQVIVQRSLSAKSLSHAKGGSVL | Uniprot ID | Q2M3M2 |
Uniprot Id
Q2M3M2
Target Species
Human
Target Name
SLC5A9
Target Full Name
Sodium/glucose cotransporter 4
Target Function
Involved in sodium-dependent transport of D-mannose, D-glucose and D-fructose.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Sodium:solute symporter (SSF) (TC 2.A.21) family
Target Tissue Specificity
Expressed in the small intestine, kidney and liver.
Target Synonyms
SLC5A9; SGLT4; Sodium/glucose cotransporter 4; Na(+)/glucose cotransporter 4; hSGLT4; Solute carrier family 5 member 9
Target Background
Predicted to enable glucose:sodium symporter activity. Predicted to be involved in sodium ion transport. Located in extracellular exosome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
