Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC6A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-599 of human SLC6A1 (NP_003033.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC6A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-599 of human SLC6A1 (NP_003033.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05275A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC6A1 |
| Target Synonyms | MAE; GAT1; GABATR; hGAT-1; GABATHG; SLC6A1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse eye | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 500-599 of human SLC6A1 (NP_003033.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WSFFTPIIVAGVFIFSAVQMTPLTMGNYVFPKWGQGVGWLMALSSMVLIPGYMAYMFLTLKGSLKQRIQVMVQPSEDIVRPENGPEQPQAGSSTSKEAYI | Uniprot ID | P30531 |
Uniprot Id
P30531
Target Species
Human
Target Name
SLC6A1
Target Full Name
Sodium- and chloride-dependent GABA transporter 1
Target Function
Terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals.
Target Involvement
Myoclonic-atonic epilepsy (MAE)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein. Cell junction, synapse, presynapse.
Target Protein Families
Sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family, SLC6A1 subfamily
Target Synonyms
GABATHG; GABATR; GABT 1; GABT1; GAT-1; GAT1; SC6A1_HUMAN; Slc6a1; Sodium and chloride dependent GABA transporter 1; Sodium- and chloride-dependent GABA transporter 1; Solute carrier family 6 (neurotransmitter transporter GABA) member 1; Solute carrier family 6 member 1
Target Background
The protein encoded by this gene is a gamma-aminobutyric acid (GABA) transporter that localizes to the plasma membrane. The encoded protein removes GABA from the synaptic cleft, restoring it to presynaptic terminals.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
