-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC6A14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 131-234 of human SLC6A14 (NP_009162.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC6A14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 131-234 of human SLC6A14 (NP_009162.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10931A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC6A14 |
| Target Synonyms | BMIQ11; SLC6A14 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, BxPC-3, HepG2, MCF7, Mouse large intestine, Mouse lung, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 131-234 of human SLC6A14 (NP_009162.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YYNVIIAYSLYYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETGV | Uniprot ID | Q9UN76 |
Uniprot Id
Q9UN76
Target Species
Human
Target Name
SLC6A14
Target Full Name
Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+)
Target Function
Mediates the uptake of a broad range of neutral and cationic amino acids (with the exception of proline) in a Na(+)/Cl(-)-dependent manner.
Target Involvement
Genetic variations in SLC6A14 may be associated with obesity in some populations, as shown by significant differences in allele frequencies between obese and non-obese individuals.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family, SLC6A14 subfamily
Target Tissue Specificity
Levels are highest in adult and fetal lung, in trachea and salivary gland. Lower levels detected in mammary gland, stomach and pituitary gland, and very low levels in colon, uterus, prostate and testis.
Target Synonyms
SLC6A14; Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+; Amino acid transporter ATB0+; Solute carrier family 6 member 14
Target Background
This gene encodes a member of the solute carrier family 6. Members of this family are sodium and chloride dependent neurotransmitter transporters. The encoded protein transports both neutral and cationic amino acids. This protein may also function as a beta-alanine carrier. Mutations in this gene may be associated with X-linked obesity. A pseudogene of this gene is found on chromosome X.
Notification