-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC6A15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human SLC6A15 (NP_877499.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC6A15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human SLC6A15 (NP_877499.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01520A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC6A15 |
| Target Synonyms | V7-3; NTT73; SBAT1; hv7-3; SLC6A15 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human SLC6A15 (NP_877499.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LVVFAVLGFKANVINEKCITQNSETIMKFLKMGNISQDIIPHHINLSTVTAEDYHLVYDIIQKVKEEEFPALHLNSCKIEEELNKAVQGTGLAFIAFTEAM | Uniprot ID | Q9H2J7 |
Uniprot Id
Q9H2J7
Target Species
Human
Target Name
SLC6A15
Target Full Name
Sodium-dependent neutral amino acid transporter B(0)AT2
Target Function
Functions as a sodium-dependent neutral amino acid transporter. Exhibits preference for the branched-chain amino acids, particularly leucine, valine and isoleucine and methionine. Mediates the saturable, pH-sensitive and electrogenic cotransport of proline and sodium ions with a stoichiometry of 1:1. May have a role as transporter for neurotransmitter precursors into neurons. In contrast to other members of the neurotransmitter transporter family, does not appear to be chloride-dependent.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family, SLC6A15 subfamily
Target Tissue Specificity
Almost exclusively expressed in the brain.
Target Synonyms
hv7 3; MGC87066; NTT73; Orphan sodium and chloride dependent neurotransmitter transporter NTT73; Orphan transporter v7 3; S6A15_HUMAN; SBAT1; SLC6A15; sodium- and chloride-dependent neurotransmitter transporter NTT73; Sodium-coupled branched-chain amino-acid transporter 1; Sodium-dependent neutral amino acid transporter B(0)AT2; Solute carrier family 6 (neutral amino acid transporter) member 15; Solute carrier family 6 member 15; Transporter v7-3; V7 3
Target Background
This gene encodes a member of the solute carrier family 6 protein family which transports neutral amino acids. The encoded protein is thought to play a role in neuronal amino acid transport (PMID: 16185194) and may be associated with major depression (PMID: 21521612). Multiple transcript variants encoding different isoforms have been found for this gene.
Notification