Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC6A9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SLC6A9 (NP_964012.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC6A9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SLC6A9 (NP_964012.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11345A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC6A9 |
| Target Synonyms | GLYT1; GCENSG; SLC6A9 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, K-562, MCF7, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SLC6A9 (NP_964012.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSGGDTRAAIARPRMAAAHGPVAPSSPEQVTLLPVQRSFFLPPFSGATPSTSLAESVLKVWHGAYNSGLLPQLMAQHSLAMAQNGAVPSEATKRDQNLKRGNWGNQIEFV | Uniprot ID | P48067 |
Uniprot Id
P48067
Target Species
Human
Target Name
SLC6A9
Target Full Name
Sodium- and chloride-dependent glycine transporter 1
Target Function
Terminates the action of glycine by its high affinity sodium-dependent reuptake into presynaptic terminals. May play a role in regulation of glycine levels in NMDA receptor-mediated neurotransmission.
Target Involvement
Glycine encephalopathy with normal serum glycine (GCENSG)
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family, SLC6A9 subfamily
Target Tissue Specificity
Isoform GlyT-1A and isoform GlyT-1B can be found in brain, kidney, pancreas, lung, placenta and liver but isoform GlyT-1C is only found in brain.
Target Synonyms
glycine transporter 1; Glyt 1; GlyT-1; GlyT1; SC6A9_HUMAN; SLC6A9; Sodium and chloride dependent glycine transporter 1; Sodium- and chloride-dependent glycine transporter 1; Solute carrier family 6 member 9
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
