Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC7A2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC7A2 (NP_001008539.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC7A2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC7A2 (NP_001008539.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08525A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC7A2 |
| Target Synonyms | CAT2; ATRC2; HCAT2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC7A2 (NP_001008539.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LVLLFVMVAGFVKGNVANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATCFYAFVGFDCIATTGEEVRNPQKAIPIGIVTSLLVCF | Uniprot ID | P52569 |
Uniprot Id
P52569
Target Species
Human
Target Name
SLC7A2
Target Full Name
Cationic amino acid transporter 2
Target Function
Functions as permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine); the affinity for its substrates differs between isoforms created by alternative splicing. Isoform 1 functions as permease that mediates the transport of the cationic amino acids (arginine, lysine and ornithine), and it has much higher affinity for arginine than isoform 2. Isoform 2 functions as low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). May play a role in classical or alternative activation of macrophages via its role in arginine transport.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Amino acid-polyamine-organocation (APC) superfamily, Cationic amino acid transporter (CAT) (TC 2.A.3.3) family
Target Tissue Specificity
Expressed at high levels in the skeletal muscle, placenta and ovary. Expressed at intermediate levels in the liver and pancreas and at low levels in the kidney and heart.
Target Synonyms
ATRC2; 20.5; Amino acid transporter; cationic 2 (low affinity); ATRC 2; CAT 2; CAT-2; CAT2; Cat2a; Cat2b; Cationic amino acid transporter 2A; cationic amino acid transporter; y+ system; low affinity cationic amino acid transporter 2; CTR2_HUMAN; HCAT 2; HCAT2; Low affinity cationic amino acid transporter 2; OTTHUMP00000216432; OTTHUMP00000216433; OTTMUSP00000041667; OTTMUSP00000041669; RCAT2; SLC7A 2; Slc7a2; Solute carrier family 7 member 2; T cell early activation protein; Tea
Target Background
The protein encoded by this gene is a cationic amino acid transporter and a member of the APC (amino acid-polyamine-organocation) family of transporters. The encoded membrane protein is responsible for the cellular uptake of arginine, lysine and ornithine. Three transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
