-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC8A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 600-700 of human SLC8A1 (NP_066920.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SLC8A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 600-700 of human SLC8A1 (NP_066920.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-11192A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC8A1 |
| Target Synonyms | NCX1; SLC8A1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse brain, RD, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 600-700 of human SLC8A1 (NP_066920.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DEIVKTISVKVIDDEEYEKNKTFFLEIGEPRLVEMSEKKALLLNELGGFTITGKYLFGQPVFRKVHAREHPILSTVITIADEYDDKQPLTSKEEEERRIAE | Uniprot ID | P32418 |
Uniprot Id
P32418
Target Species
Human
Target Name
SLC8A1
Target Full Name
Sodium/calcium exchanger 1
Target Function
Mediates the exchange of one Ca(2+) ion against three to four Na(+) ions across the cell membrane, and thereby contributes to the regulation of cytoplasmic Ca(2+) levels and Ca(2+)-dependent cellular processes. Contributes to Ca(2+) transport during excitation-contraction coupling in muscle. In a first phase, voltage-gated channels mediate the rapid increase of cytoplasmic Ca(2+) levels due to release of Ca(2+) stores from the endoplasmic reticulum. SLC8A1 mediates the export of Ca(2+) from the cell during the next phase, so that cytoplasmic Ca(2+) levels rapidly return to baseline. Required for normal embryonic heart development and the onset of heart contractions.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Ca(2+):cation antiporter (CaCA) (TC 2.A.19) family, SLC8 subfamily
Target Tissue Specificity
Detected primarily in heart and at lower levels in brain. Expressed in cardiac sarcolemma, brain, kidney, liver, pancreas, skeletal muscle, placenta and lung.
Target Research Area
others
Target Synonyms
CNC; DKFZp779F0871; MGC119581; Na(+)/Ca(2+)-exchange protein 1; Na+/Ca2+ exchange protein 1; Na+/Ca2+ exchanger; NAC1_HUMAN; NCX 1; NCX; NCX1; SLC8A1; SLC8A1 protein; Sodium Calcium Exchanger; Sodium/calcium exchanger 1; Solute carrier family 8 (sodium/calcium exchanger) member 1; Solute carrier family 8 member 1
Target Background
In cardiac myocytes, Ca(2+) concentrations alternate between high levels during contraction and low levels during relaxation. The increase in Ca(2+) concentration during contraction is primarily due to release of Ca(2+) from intracellular stores. However, some Ca(2+) also enters the cell through the sarcolemma (plasma membrane). During relaxation, Ca(2+) is sequestered within the intracellular stores. To prevent overloading of intracellular stores, the Ca(2+) that entered across the sarcolemma must be extruded from the cell. The Na(+)-Ca(2+) exchanger is the primary mechanism by which the Ca(2+) is extruded from the cell during relaxation. In the heart, the exchanger may play a key role in digitalis action. The exchanger is the dominant mechanism in returning the cardiac myocyte to its resting state following excitation.
Notification