-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC8A3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 550-650 of human SLC8A3 (NP_489479.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC8A3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 550-650 of human SLC8A3 (NP_489479.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07273A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC8A3 |
| Target Synonyms | NCX3; SLC8A3 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Mouse skeletal muscle | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 550-650 of human SLC8A3 (NP_489479.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDTYGELEFKNDETVKTIRVKIVDEEEYERQENFFIALGEPKWMERGISALLLSPDRKLTMEEEEAKRIA | Uniprot ID | P57103 |
Uniprot Id
P57103
Target Species
Human
Target Name
SLC8A3
Target Full Name
Sodium/calcium exchanger 3
Target Function
Mediates the electrogenic exchange of Ca(2+) against Na(+) ions across the cell membrane, and thereby contributes to the regulation of cytoplasmic Ca(2+) levels and Ca(2+)-dependent cellular processes. Contributes to cellular Ca(2+) homeostasis in excitable cells, both in muscle and in brain. In a first phase, voltage-gated channels mediate the rapid increase of cytoplasmic Ca(2+) levels due to release of Ca(2+) stores from the endoplasmic reticulum. SLC8A3 mediates the export of Ca(2+) from the cell during the next phase, so that cytoplasmic Ca(2+) levels rapidly return to baseline. Contributes to Ca(2+) transport during excitation-contraction coupling in muscle. In neurons, contributes to the rapid decrease of cytoplasmic Ca(2+) levels back to baseline after neuronal activation, and thereby contributes to modulate synaptic plasticity, learning and memory. Required for normal oligodendrocyte differentiation and for normal myelination. Mediates Ca(2+) efflux from mitochondria and contributes to mitochondrial Ca(2+) ion homeostasis.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Perikaryon. Cell projection, dendrite. Cell projection, dendritic spine. Cell membrane, sarcolemma. Cytoplasm, sarcoplasm. Cell junction. Mitochondrion outer membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
Ca(2+):cation antiporter (CaCA) (TC 2.A.19) family, SLC8 subfamily
Target Tissue Specificity
Isoform 2 is expressed in brain and skeletal muscle. Isoform 3 is expressed in excitable cells of brain, retina and skeletal muscle. Isoform 4 is expressed in skeletal muscle.
Target Synonyms
SLC8A3; NCX3; Sodium/calcium exchanger 3; Na(+)/Ca(2+)-exchange protein 3; Solute carrier family 8 member 3
Target Background
This gene encodes a member of the sodium/calcium exchanger integral membrane protein family. Na+/Ca2+ exchange proteins are involved in maintaining Ca2+ homeostasis in a wide variety of cell types. The protein is regulated by intracellular calcium ions and is found in both the plasma membrane and intracellular organellar membranes, where exchange of Na+ for Ca2+ occurs in an electrogenic manner. Alternative splicing has been observed for this gene and multiple variants have been described.
Notification