-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLCO1C1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 450-554 of human SLCO1C1 (Q9NYB5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLCO1C1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 450-554 of human SLCO1C1 (Q9NYB5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01017A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLCO1C1 |
| Target Synonyms | OATP1; OATPF; OATP-F; OATP14; OATP1C1; OATPRP5; OATP-RP5; SLC21A14; SLCO1C1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Jurkat, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 450-554 of human SLCO1C1 (Q9NYB5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SDVAGLTVSYQGTKPVSYHERALFSDCNSRCKCSETKWEPMCGENGITYVSACLAGCQTSNRSGKNIIFYNCTCVGIAASKSGNSSGIVGRCQKDNGCPQMFLYF | Uniprot ID | Q9NYB5 |
Uniprot Id
Q9NYB5
Target Species
Human
Target Name
SLCO1C1
Target Full Name
Solute carrier organic anion transporter family member 1C1
Target Function
Mediates the Na(+)-independent high affinity transport of organic anions such as the thyroid hormones thyroxine (T4) and rT3. Other potential substrates, such as triiodothyronine (T3), 17-beta-glucuronosyl estradiol, estrone-3-sulfate and sulfobromophthalein (BSP) are transported with much lower efficiency. May play a significant role in regulating T4 flux into and out of the brain.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Organo anion transporter (TC 2.A.60) family
Target Tissue Specificity
Highly expressed in brain and in Leydig cells in testis. Detected in many brain regions with the exception of pons and cerebellum. Not strongly enriched in cerebral microvessels.
Target Synonyms
OAT-RP-5; OATP-14; OATP-F; OATP1; OATP1C1; OATPRP5; Organic anion transporter F; Organic anion transporter polypeptide-related protein 5; organic anion transporting polypeptide 14; Organic anion-transporting polypeptide 14; SLC21A14; Slco1c1; SO1C1_HUMAN; solute carrier family 21 (organic anion transporter), member 14; Solute carrier family 21 member 14; Solute carrier organic anion transporter family member 1C1; solute carrier organic anion transporter family, member 1C1; Thyroxine transporter
Target Background
This gene encodes a member of the organic anion transporter family. The encoded protein is a transmembrane receptor that mediates the sodium-independent uptake of thyroid hormones in brain tissues. This protein has particularly high affinity for the thyroid hormones thyroxine, tri-iodothyronine and reverse tri-iodothyronine. Polymorphisms in the gene encoding this protein may be associated with fatigue and depression in patients suffering from hyperthyroidism. Alternative splicing results in multiple transcript variants.
Notification