Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLCO3A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 440-540 of human SLCO3A1 (NP_037404.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLCO3A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 440-540 of human SLCO3A1 (NP_037404.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05756A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLCO3A1 |
| Target Synonyms | OATPD; OATP-D; OATP3A1; OATPRP3; OATP-RP3; SLC21A11; SLCO3A1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, A-549, Mouse lung, Mouse thymus, Rat thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 440-540 of human SLCO3A1 (NP_037404.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FLGCDTGPVAGVTVPYGNSTAPGSALDPYSPCNNNCECQTDSFTPVCGADGITYLSACFAGCNSTNLTGCACLTTVPAENATVVPGKCPSPGCQEAFLTFL | Uniprot ID | Q9UIG8 |
Uniprot Id
Q9UIG8
Target Species
Human
Target Name
SLCO3A1
Target Full Name
Solute carrier organic anion transporter family member 3A1
Target Function
Mediates the Na(+)-independent transport of organic anions such as estrone-3-sulfate. Mediates transport of prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123 and vasopressin, but not DPDPE (a derivative of enkephalin lacking an N-terminal tyrosine residue), estrone-3-sulfate, taurocholate, digoxin nor DHEAS.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Organo anion transporter (TC 2.A.60) family
Target Tissue Specificity
Ubiquitous. Highly expressed in spleen and leukocytes. Generally the expression of isoform 1 is higher than that of isoform 2. Isoform 2 is particularly abundant in testis and brain. In testis, isoform 1 is detected in spermatogonia at different stages an
Target Synonyms
SLCO3A1; OATP3A1; OATPD; SLC21A11; Solute carrier organic anion transporter family member 3A1; OATP3A1; Organic anion transporter polypeptide-related protein 3; OATP-RP3; OATPRP3; Organic anion-transporting polypeptide D; OATP-D; PGE1 transporter; Sodium-independent organic anion transporter D; Solute carrier family 21 member 11
Target Background
Predicted to enable sodium-independent organic anion transmembrane transporter activity. Involved in positive regulation of NF-kappaB transcription factor activity; positive regulation of protein phosphorylation; and prostaglandin transport. Located in plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
