Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLCO6A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 480-580 of human SLCO6A1 (NP_775759.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLCO6A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 480-580 of human SLCO6A1 (NP_775759.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05342A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLCO6A1 |
| Target Synonyms | GST; CT48; OATPY; OATP-I; OATP6A1; SLCO6A1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, Mouse brain, NCI-H460, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 480-580 of human SLCO6A1 (NP_775759.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VQFAGINEDYDGTGKLGNLTAPCNEKCRCSSSIYSSICGRDDIEYFSPCFAGCTYSKAQNQKKMYYNCSCIKEGLITADAEGDFIDARPGKCDAKCYKLPL | Uniprot ID | Q86UG4 |
Uniprot Id
Q86UG4
Target Species
Human
Target Name
SLCO6A1
Target Full Name
Solute carrier organic anion transporter family member 6A1
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Organo anion transporter (TC 2.A.60) family
Target Tissue Specificity
Strongly expressed in testis. Weakly expressed in spleen, brain, fetal brain and placenta. Detected in lung tumors.
Target Synonyms
SLCO6A1; OATP6A1; SLC21A19; Solute carrier organic anion transporter family member 6A1; Cancer/testis antigen 48; CT48; Gonad-specific transporter; GST; Organic anion-transporting polypeptide 6A1; Organic anion-transporting polypeptide I; OATP-I; Solute carrier family 21 member 19
Target Background
Predicted to enable sodium-independent organic anion transmembrane transporter activity. Predicted to be involved in sodium-independent organic anion transport. Predicted to be located in plasma membrane. Predicted to be integral component of membrane. Predicted to be integral component of plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
