-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLFN11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 132-328 of human SLFN11 (NP_689483.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLFN11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 132-328 of human SLFN11 (NP_689483.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00191A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLFN11 |
| Target Synonyms | SLFN8/9; SLFN11 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | DU145, OVCAR3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 132-328 of human SLFN11 (NP_689483.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LYRRSETSVRSMDSREAFCFLKTKRKPKILEEGPFHKIHKGVYQELPNSDPADPNSDPADLIFQKDYLEYGEILPFPESQLVEFKQFSTKHFQEYVKRTIPEYVPAFANTGGGYLFIGVDDKSREVLGCAKENVDPDSLRRKIEQAIYKLPCVHFCQPQRPITFTLKIVNVLKRGELYGYACMIRVNPFCCAVFSEA | Uniprot ID | Q7Z7L1 |
Uniprot Id
Q7Z7L1
Target Species
Human
Target Name
SLFN11
Target Full Name
Schlafen family member 11
Target Function
Inhibitor of DNA replication that promotes cell death in response to DNA damage. Acts as a guardian of the genome by killing cells with defective replication. Persistently blocks stressed replication forks by opening chromatin across replication initiation sites at stressed replication forks, possibly leading to unwind DNA ahead of the MCM helicase and block fork progression, ultimately leading to cell death. Acts independently of ATR. Also acts as an interferon (IFN)-induced antiviral protein which acts as an inhibitor of retrovirus protein synthesis. Specifically abrogates the production of retroviruses such as human immunodeficiency virus 1 (HIV-1) by acting as a specific inhibitor of the synthesis of retroviruses encoded proteins in a codon-usage-dependent manner. Binds to tRNAs and exploits the unique viral codon bias towards A/T nucleotides. The exact inhibition mechanism is unclear: may either sequester tRNAs, prevent their maturation via post-transcriptional processing or may accelerate their deacylation. Does not inhibit reverse transcription, integration or production and nuclear export of viral RNA.
Target Subcellular Location
Nucleus. Chromosome.
Target Protein Families
Schlafen family
Target Tissue Specificity
Exhibits a wider expression range in ovarian and colon adenocarcinoma than in their corresponding healthy tissues.
Target Research Area
Cell Biology
Target Synonyms
SLFN11; Schlafen family member 11; EC 3.6.-.-
Target Background
Enables tRNA binding activity. Involved in several processes, including defense response to virus; negative regulation of G1/S transition of mitotic cell cycle; and replication fork arrest. Located in cytosol; nucleoplasm; and site of DNA damage.
Notification