Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLITRK4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 648-837 of human SLITRK4 (NP_775101.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLITRK4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 648-837 of human SLITRK4 (NP_775101.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03342A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLITRK4 |
| Target Synonyms | SLITRK4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, Mouse liver, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 648-837 of human SLITRK4 (NP_775101.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KPTVKHEGLGNPDCGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHTCGLKESETGFMFSDPPGQKVVMRNVADKEKDLLHVDTRKRLSTIDELDELFPSRDSNVFIQNFLESKKEYNSIGVSGFEIRYPEKQPDKKSKKSLIGGNHSKIVVEQRKSEYFELKAKLQSSPDYLQVLEEQTALNKI | Uniprot ID | Q8IW52 |
Uniprot Id
Q8IW52
Target Species
Human
Target Name
SLITRK4
Target Full Name
SLIT and NTRK-like protein 4
Target Function
It is involved in synaptogenesis and promotes synapse differentiation. Suppresses neurite outgrowth.
Target Subcellular Location
Membrane; Single-pass type I membrane protein. Cell membrane.
Target Protein Families
SLITRK family
Target Tissue Specificity
Expressed in the cerebral cortex of the brain and at higher levels in some astrocytic brain tumors such as astrocytomas, glioblastomas and primitive neuroectodermal tumors.
Target Synonyms
SLITRK4
Target Background
This gene encodes a transmembrane protein belonging to the the SLITRK family. These family members include two N-terminal leucine-rich repeat domains similar to those found in the axonal growth-controlling protein SLIT, as well as C-terminal regions similar to neurotrophin receptors. Studies of an homologous protein in mouse suggest that this family member functions to suppress neurite outgrowth. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
