-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLPI was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-132 of human SLPI (NP_003055.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLPI was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-132 of human SLPI (NP_003055.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06803A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLPI |
| Target Synonyms | ALP; MPI; ALK1; BLPI; HUSI; WAP4; WFDC4; HUSI-I; SLPI | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Mouse spleen, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 26-132 of human SLPI (NP_003055.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA | Uniprot ID | P03973 |
Uniprot Id
P03973
Target Species
Human
Target Name
SLPI
Target Full Name
Antileukoproteinase
Target Function
Acid-stable proteinase inhibitor with strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G. Modulates the inflammatory and immune responses after bacterial infection, and after infection by the intracellular parasite L.major. Down-regulates responses to bacterial lipopolysaccharide (LPS). Plays a role in regulating the activation of NF-kappa-B and inflammatory responses. Has antimicrobial activity against mycobacteria, but not against salmonella. Contributes to normal resistance against infection by M.tuberculosis. Required for normal resistance to infection by L.major. Required for normal wound healing, probably by preventing tissue damage by limiting protease activity. Together with ELANE, required for normal differentiation and proliferation of bone marrow myeloid cells.
Target Subcellular Location
Secreted.
Target Tissue Specificity
Detected in blood plasma. Detected in bone marrow myeloid cells. Detected in airway sputum. Detected in parotid gland secretions. Detected in seminal plasma (at protein level). Detected in uterus cervix.
Target Research Area
Cardiovascular
Target Synonyms
ALK 1; ALK1; ALP; Antileukoprotease; Antileukoproteinase 1; Antileukoproteinase; Antileukoproteinase1; BLPI; Human seminal protease inhibitor; HUSI 1; HUSI; HUSI I; HUSI-1; MPI; Mucus proteinase inhibitor; Protease inhibitor WAP4; Secretory leukocyte peptidase inhibitor; Secretory leukocyte protease inhibitor; Seminal proteinase inhibitor; SLPI; SLPI_HUMAN; WAP four disulfide core domain protein 4; WAP four-disulfide core domain protein 4; WAP4; WFDC4
Target Background
This gene encodes a secreted inhibitor which protects epithelial tissues from serine proteases. It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cathepsin G. Its inhibitory effect contributes to the immune response by protecting epithelial surfaces from attack by endogenous proteolytic enzymes. This antimicrobial protein has antibacterial, antifungal and antiviral activity.
Notification