-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Slug was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 21-120 of human Slug (NP_003059.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Slug was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 21-120 of human Slug (NP_003059.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-10323A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Slug |
| Target Synonyms | SLUG; WS2D; SLUGH; SLUGH1; SNAIL2; Slug | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Rat lung, Rat spleen | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 21-120 of human Slug (NP_003059.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDP | Uniprot ID | O43623 |
Uniprot Id
O43623
Target Species
Human
Target Name
SNAI2
Target Full Name
Zinc finger protein SNAI2
Target Function
Transcriptional repressor that modulates both activator-dependent and basal transcription. Involved in the generation and migration of neural crest cells. Plays a role in mediating RAF1-induced transcriptional repression of the TJ protein, occludin (OCLN) and subsequent oncogenic transformation of epithelial cells. Represses BRCA2 expression by binding to its E2-box-containing silencer and recruiting CTBP1 and HDAC1 in breast cells. In epidermal keratinocytes, binds to the E-box in ITGA3 promoter and represses its transcription. Involved in the regulation of ITGB1 and ITGB4 expression and cell adhesion and proliferation in epidermal keratinocytes. Binds to E-box2 domain of BSG and activates its expression during TGFB1-induced epithelial-mesenchymal transition (EMT) in hepatocytes. Represses E-Cadherin/CDH1 transcription via E-box elements. Involved in osteoblast maturation. Binds to RUNX2 and SOC9 promoters and may act as a positive and negative transcription regulator, respectively, in osteoblasts. Binds to CXCL12 promoter via E-box regions in mesenchymal stem cells and osteoblasts. Plays an essential role in TWIST1-induced EMT and its ability to promote invasion and metastasis.
Target Involvement
Waardenburg syndrome 2D (WS2D); Piebald trait (PBT)
Target Subcellular Location
Nucleus. Cytoplasm. Note=Observed in discrete foci in interphase nuclei. These nuclear foci do not overlap with the nucleoli, the SP100 and the HP1 heterochromatin or the coiled body, suggesting SNAI2 is associated with active transcription or active splicing regions.
Target Protein Families
Snail C2H2-type zinc-finger protein family
Target Tissue Specificity
Expressed in most adult human tissues, including spleen, thymus, prostate, testis, ovary, small intestine, colon, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Not detected in peripheral blood leukocyte. Expressed in the dermi
Target Synonyms
MGC10182; Neural crest transcription factor Slug; Protein snail homolog 2; Slug (chicken homolog) zinc finger protein; Slug homolog zinc finger protein; Slug zinc finger protein; SLUGH; SLUGH 1; SLUGH1; SNAI 2; Snai2; SNAI2_HUMAN; Snail 2; Snail homolog 2; Snail2; WS 2D; WS2D; Zinc finger protein SLUG; Zinc finger protein SNAI2
Target Background
This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects.
Notification