-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Smad6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 231-330 of human Smad6 (NP_005576.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB.
The antibody against Smad6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 231-330 of human Smad6 (NP_005576.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB.
| Cat.No | ADA-08279A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SMAD6 |
| Target Synonyms | AOVD2; MADH6; MADH7; HsT17432; Smad6 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A549 | Application | WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 231-330 of human Smad6 (NP_005576.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RWPDLQHAVELKPLCGCHSFAAAADGPTVCCNPYHFSRLCGPESPPPPYSRLSPRDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSH | Uniprot ID | O43541 |
Uniprot Id
O43541
Target Species
Human
Target Name
SMAD6
Target Full Name
Mothers against decapentaplegic homolog 6
Target Function
Transforming growth factor-beta superfamily receptors signaling occurs through the Smad family of intracellular mediators. SMAD6 is an inhibitory Smad (i-Smad) that negatively regulates signaling downstream of type I transforming growth factor-beta. Acts as a mediator of TGF-beta and BMP anti-inflammatory activities. Suppresses IL1R-TLR signaling through its direct interaction with PEL1, preventing NF-kappa-B activation, nuclear transport and NF-kappa-B-mediated expression of proinflammatory genes. Blocks the BMP-SMAD1 signaling pathway by competing with SMAD4 for receptor-activated SMAD1-binding. Binds to regulatory elements in target promoter regions.
Target Involvement
Aortic valve disease 2 (AOVD2); Craniosynostosis 7 (CRS7)
Target Subcellular Location
Nucleus.
Target Protein Families
Dwarfin/SMAD family
Target Tissue Specificity
Ubiquitous in various organs, with higher levels in lung. Isoform B is up-regulated in diseased heart tissue.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
hSMAD6; MAD homolog 6; MADH6; MADH7; Mothers against decapentaplegic homolog 6; Mothers against DPP homolog 6; SMAD 6; SMAD family member 6; SMAD mothers against DPP homolog 6; Smad6; SMAD6_HUMAN
Target Background
The protein encoded by this gene belongs to the SMAD family of proteins, which are related to Drosophila 'mothers against decapentaplegic' (Mad) and C. elegans Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions in the negative regulation of BMP and TGF-beta/activin-signalling. Multiple transcript variants have been found for this gene.
Notification