Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SMAP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-250 of human SMAP1 (NP_001037770) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SMAP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-250 of human SMAP1 (NP_001037770) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07071A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SMAP1 |
| Target Synonyms | SMAP-1; SMAP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 180-250 of human SMAP1 (NP_001037770). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EPEKPAKPLTAEKLQKKDQQLEPKKSTSPKKAAEPTVDLLGLDGPAVAPVTNGNTTVPPLNDDLDIFGPMI | Uniprot ID | Q8IYB5 |
Uniprot Id
Q8IYB5
Target Species
Human
Target Name
SMAP1
Target Full Name
Stromal membrane-associated protein 1
Target Function
GTPase activating protein that acts on ARF6. Plays a role in clathrin-dependent endocytosis. May play a role in erythropoiesis.
Target Subcellular Location
Cell membrane; Peripheral membrane protein; Cytoplasmic side.
Target Tissue Specificity
Detected in bone marrow, adrenal gland, trachea, lymph node, spinal cord, peripheral blood leukocytes, thyroid and stomach.
Target Synonyms
SMAP1; Stromal membrane-associated protein 1
Target Background
The protein encoded by this gene is similar to the mouse stromal membrane-associated protein-1. This similarity suggests that this human gene product is also a type II membrane glycoprotein involved in the erythropoietic stimulatory activity of stromal cells. Alternate splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
