-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SMARCAL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-900 of human SMARCAL1 (NP_001120679.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SMARCAL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800-900 of human SMARCAL1 (NP_001120679.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00213A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SMARCAL1 |
| Target Synonyms | HARP; HHARP; SMARCAL1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 800-900 of human SMARCAL1 (NP_001120679.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VFAELFWNPGVLIQAEDRVHRIGQTSSVGIHYLVAKGTADDYLWPLIQEKIKVLAEAGLSETNFSEMTESTDYLYKDPKQQKIYDLFQKSFEKEGSDMELL | Uniprot ID | Q9NZC9 |
Uniprot Id
Q9NZC9
Target Species
Human
Target Name
SMARCAL1
Target Full Name
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1
Target Function
ATP-dependent annealing helicase that binds selectively to fork DNA relative to ssDNA or dsDNA and catalyzes the rewinding of the stably unwound DNA. Rewinds single-stranded DNA bubbles that are stably bound by replication protein A (RPA). Acts throughout the genome to reanneal stably unwound DNA, performing the opposite reaction of many enzymes, such as helicases and polymerases, that unwind DNA. May play an important role in DNA damage response by acting at stalled replication forks.
Target Involvement
Schimke immuno-osseous dysplasia (SIOD)
Target Subcellular Location
Nucleus. Note=Recruited to damaged DNA regions.
Target Protein Families
SNF2/RAD54 helicase family, SMARCAL1 subfamily
Target Tissue Specificity
Ubiquitously expressed, with high levels in testis.
Target Synonyms
HARP; HepA Related Protein; HepA-related protein; hHARP; SIOD; SMAL1_HUMAN; SMARCA like Protein 1; smarcal1; Sucrose nonfermenting protein 2 like 1; Sucrose nonfermenting protein 2-like 1; SWI/SNF Related; SWI/SNF related matrix associated actin dependent regulator of chromatin subfamily A like protein 1; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1
Target Background
The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein shows sequence similarity to the E. coli RNA polymerase-binding protein HepA. Mutations in this gene are a cause of Schimke immunoosseous dysplasia (SIOD), an autosomal recessive disorder with the diagnostic features of spondyloepiphyseal dysplasia, renal dysfunction, and T-cell immunodeficiency.
Notification