-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SMC3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1118-1217 of human SMC3 (NP_005436.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against SMC3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1118-1217 of human SMC3 (NP_005436.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-14340A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SMC3 |
| Target Synonyms | BAM; BMH; HCAP; CDLS3; CSPG6; SMC3L1; SMC3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, NIH/3T3, Jurkat, Mouse brain, Mouse spleen, U-87MG | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1118-1217 of human SMC3 (NP_005436.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTHG | Uniprot ID | Q9UQE7 |
Uniprot Id
Q9UQE7
Target Species
Human
Target Name
SMC3
Target Full Name
Structural maintenance of chromosomes protein 3
Target Function
Central component of cohesin, a complex required for chromosome cohesion during the cell cycle. The cohesin complex may form a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. Cohesion is coupled to DNA replication and is involved in DNA repair. The cohesin complex plays also an important role in spindle pole assembly during mitosis and in chromosomes movement.
Target Involvement
Cornelia de Lange syndrome 3 (CDLS3)
Target Subcellular Location
Nucleus. Chromosome. Chromosome, centromere.
Target Protein Families
SMC family, SMC3 subfamily
Target Synonyms
BAM; Bamacan; Basement membrane associated chondroitin proteoglycan; Basement membrane-associated chondroitin proteoglycan; BMH; CDLS3; chondroitin sulfate proteoglycan 6 (bamacan); Chondroitin sulfate proteoglycan 6; Chromosome associated polypeptide; Chromosome-associated polypeptide; CSPG 6; CSPG6; hCAP; Human chromosome associated polypeptide; im:7142991; SMC 3; SMC protein 3; SMC-3; smc3; SMC3_HUMAN; SMC3L1; Structural maintenance of chromosome 3; Structural maintenance of chromosomes 3; Structural maintenance of chromosomes protein 3; u:fb22e01; wu:fc30d07
Target Background
This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein.
Notification