-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SMC4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1189-1288 of human SMC4 (Q9NTJ3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SMC4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1189-1288 of human SMC4 (Q9NTJ3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14157A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SMC4 |
| Target Synonyms | CAPC; CAP-C; SMC-4; SMC4L1; SMC4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, NIH/3T3, HT-29, Mouse testis, Mouse thymus, Raji, Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1189-1288 of human SMC4 (Q9NTJ3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FNLSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNVSIVAFYIYEQTKNAQFIIISLRNNMFEISDRLIGIYKTYNITKSVAVNPKEIASKGLC | Uniprot ID | Q9NTJ3 |
Uniprot Id
Q9NTJ3
Target Species
Human
Target Name
SMC4
Target Full Name
Structural maintenance of chromosomes protein 4
Target Function
Central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.
Target Subcellular Location
Nucleus. Cytoplasm. Chromosome. Note=In interphase cells, the majority of the condensin complex is found in the cytoplasm, while a minority of the complex is associated with chromatin. A subpopulation of the complex however remains associated with chromosome foci in interphase cells. During mitosis, most of the condensin complex is associated with the chromatin. At the onset of prophase, the regulatory subunits of the complex are phosphorylated by CDC2, leading to condensin's association with chromosome arms and to chromosome condensation. Dissociation from chromosomes is observed in late telophase.
Target Protein Families
SMC family, SMC4 subfamily
Target Tissue Specificity
Widely expressed. Higher expression in testis, colon, thymus.
Target Synonyms
CAP C; CAPC; Chromosome associated polypeptide C; Chromosome-associated polypeptide C; hCAP C; hCAP-C; SMC 4; SMC protein 4; SMC-4; SMC4; SMC4_HUMAN; SMC4L1; Structural maintenance of chromosomes 4; Structural maintenance of chromosomes 4 like 1; Structural maintenance of chromosomes protein 4; XCAP C homolog; XCAP-C homolog
Target Background
This gene belongs to the 'structural maintenance of chromosomes' (SMC) gene family. Members of this gene family play a role in two changes in chromosome structure during mitotic segregation of chromosomes- chromosome condensation and sister chromatid cohesion. The protein encoded by this gene is likely a subunit of the 13S condensin complex, which is involved in chromosome condensation. A pseudogene related to this gene is located on chromosome 2.
Notification