Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SNAI3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 7-186 of human SNAI3 (NP_840101.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SNAI3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 7-186 of human SNAI3 (NP_840101.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07145A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SNAI3 |
| Target Synonyms | SMUC; SNAIL3; ZNF293; Zfp293; SNAI3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Mouse thymus, Rat thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 7-186 of human SNAI3 (NP_840101.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VKTHSSHRVPNYRRLETQREINGACSACGGLVVPLLPRDKEAPSVPGDLPQPWDRSSAVACISLPLLPRIEEALGASGLDALEVSEVDPRASRAAIVPLKDSLNHLNLPPLLVLPTRWSPTLGPDRHGAPEKLLGAERMPRAPGGFECFHCHKPYHTLAGLARHRQLHCHLQVGRVFTCK | Uniprot ID | Q3KNW1 |
Uniprot Id
Q3KNW1
Target Species
Human
Target Name
SNAI3
Target Full Name
Zinc finger protein SNAI3
Target Function
Seems to inhibit myoblast differentiation. Transcriptional repressor of E-box-dependent transactivation of downstream myogenic bHLHs genes. Binds preferentially to the canonical E-box sequences 5'-CAGGTG-3' and 5'-CACCTG-3'.
Target Subcellular Location
Nucleus.
Target Protein Families
Snail C2H2-type zinc-finger protein family
Target Synonyms
MGC129606; Protein snail homolog 3; SMUC; SNAI3; SNAI3_HUMAN; Snail homolog 3 (Drosophila); SNAIL3; Zfp293; Zinc finger protein 293; Zinc finger protein SNAI3; ZNF293
Target Background
SNAI3 is a member of the SNAIL gene family, named for the Drosophila snail gene, which plays roles in mesodermal formation during embryogenesis (Katoh and Katoh, 2003 [PubMed 12579345]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
