Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SNRPD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-119 of human SNRPD1 (NP_008869.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against SNRPD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-119 of human SNRPD1 (NP_008869.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of MCF-7 cells using SNRPD1 antibody.
| Cat.No | ADA-02620A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SNRPD1 |
| Target Synonyms | SMD1; SNRPD; Sm-D1; HsT2456; SNRPD1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-119 of human SNRPD1 (NP_008869.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR | Uniprot ID | P62314 |
Uniprot Id
P62314
Target Species
Human
Target Name
SNRPD1
Target Full Name
Small nuclear ribonucleoprotein Sm D1
Target Function
Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. May act as a charged protein scaffold to promote snRNP assembly or strengthen snRNP-snRNP interactions through non-specific electrostatic contacts with RNA.
Target Subcellular Location
Cytoplasm, cytosol. Nucleus.
Target Protein Families
SnRNP core protein family
Target Synonyms
AA407109; AL023031; HsT2456; Sm D1; Sm-D autoantigen; Sm-D1; Small nuclear ribonucleoprotein D1 polypeptide; Small nuclear ribonucleoprotein Sm D1; SmD autoantigen; SMD1; SMD1_HUMAN; snRNP core protein D1; SNRPD; Snrpd1
Target Background
This gene encodes a small nuclear ribonucleoprotein that belongs to the SNRNP core protein family. The protein may act as a charged protein scaffold to promote SNRNP assembly or strengthen SNRNP-SNRNP interactions through nonspecific electrostatic contacts with RNA. Two transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
