Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SNRPE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human SNRPE (NP_003085.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SNRPE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human SNRPE (NP_003085.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
Western blot analysis of various lysates, using SNRPE Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
| Cat.No | ADA-09681A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SNRPE |
| Target Synonyms | SME; Sm-E; HYPT11; snRNP-E; SNRPE | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-431, Rat thymus | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human SNRPE (NP_003085.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN | Uniprot ID | P62304 |
Uniprot Id
P62304
Target Species
Human
Target Name
SNRPE
Target Full Name
Small nuclear ribonucleoprotein E
Target Function
Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. As part of the U7 snRNP it is involved in histone 3'-end processing.
Target Involvement
Hypotrichosis 11 (HYPT11)
Target Subcellular Location
Cytoplasm, cytosol. Nucleus.
Target Protein Families
SnRNP Sm proteins family
Target Tissue Specificity
Widely expressed. In scalp skin, it is present in the hair follicle, the epidermis, and the dermis.
Target Synonyms
AL022645; B raf; B-raf; Braf; C76690; HYPT11; RUXE_HUMAN; Sm protein E; Sm-E; Small nuclear ribonucleoprotein E; SmE; snRNP-E; snRNPE; snrpe
Target Background
The protein encoded by this gene is a core component of U small nuclear ribonucleoproteins, which are key components of the pre-mRNA processing spliceosome. The encoded protein plays a role in the 3' end processing of histone transcripts. This protein is one of the targets in the autoimmune disease systemic lupus erythematosus, and mutations in this gene have been associated with hypotrichosis. Several pseudogenes of this gene have been identified.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
