Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SNX32 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 218-285 of human SNX32 (NP_689973.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SNX32 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 218-285 of human SNX32 (NP_689973.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00036A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SNX32 |
| Target Synonyms | SNX6B; SNX32 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 218-285 of human SNX32 (NP_689973.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HTRIRDACLRADRVMRAHKCLADDYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGRVASDE | Uniprot ID | Q86XE0 |
Uniprot Id
Q86XE0
Target Species
Human
Target Name
SNX32
Target Full Name
Sorting nexin-32
Target Function
May be involved in several stages of intracellular trafficking.
Target Protein Families
Sorting nexin family
Target Synonyms
DKFZp761P1320; FLJ30934; MGC42112; MGC57276; Snx32; SNX32_HUMAN; SNX6B; Sortin nexin 32; Sortin nexin 6B; Sorting nexin-32; Sorting nexin-6B
Target Background
Predicted to enable phosphatidylinositol binding activity. Predicted to be involved in retrograde transport, endosome to Golgi. Predicted to be located in cytosol. Predicted to be active in endosome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
