-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SOCS3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 126-225 of human SOCS3 (NP_003946.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SOCS3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 126-225 of human SOCS3 (NP_003946.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14691A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SOCS3 |
| Target Synonyms | CIS3; SSI3; ATOD4; Cish3; SSI-3; SOCS-3; SOCS3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T-SOCS3-Flag, RAW 264.7+LPS | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 126-225 of human SOCS3 (NP_003946.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL | Uniprot ID | O14543 |
Uniprot Id
O14543
Target Species
Human
Target Name
SOCS3
Target Full Name
Suppressor of cytokine signaling 3
Target Function
SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including IL6ST/gp130, LIF, erythropoietin, insulin, IL12, GCSF and leptin receptors. Binding to JAK2 inhibits its kinase activity and regulates IL6 signaling. Suppresses fetal liver erythropoiesis. Regulates onset and maintenance of allergic responses mediated by T-helper type 2 cells. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Target Involvement
There is some evidence that SOCS3 may be a susceptibility gene for atopic dermatitis linked to 17q25. SOCS3 messenger RNA is significantly more highly expressed in skin from patients with atopic dermatitis than in skin from healthy controls. Furthermore, a genetic association between atopic dermatitis and a haplotype in the SOCS3 gene has been found in two independent groups of patients.
Target Tissue Specificity
Widely expressed with high expression in heart, placenta, skeletal muscle, peripheral blood leukocytes, fetal and adult lung, and fetal liver and kidney. Lower levels in thymus.
Target Synonyms
ATOD4; CIS 3; CIS-3; CIS3; Cish3; Cytokine induced SH2 protein 3; Cytokine-inducible SH2 protein 3; E2a Pbx1 target gene in fibroblasts 10; EF 10; MGC71791; SOCS 3; SOCS-3; Socs3; SOCS3_HUMAN; SSI 3; SSI-3; SSI3; STAT induced STAT inhibitor 3; STAT-induced STAT inhibitor 3; Suppressor of cytokine signaling 3
Target Background
This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene is induced by various cytokines, including IL6, IL10, and interferon (IFN)-gamma. The protein encoded by this gene can bind to JAK2 kinase, and inhibit the activity of JAK2 kinase. Studies of the mouse counterpart of this gene suggested the roles of this gene in the negative regulation of fetal liver hematopoiesis, and placental development.
Notification