-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SOD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-222 of human SOD2 (NP_000627.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against SOD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-222 of human SOD2 (NP_000627.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-17151A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SOD2 |
| Target Synonyms | GC1; IPOB; IPO-B; MNSOD; MVCD6; GClnc1; Mn-SOD; D2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-2 OS | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-222 of human SOD2 (NP_000627.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK | Uniprot ID | P04179 |
Uniprot Id
P04179
Target Species
Human
Target Name
SOD2
Target Full Name
Superoxide dismutase [Mn], mitochondrial
Target Function
Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.
Target Involvement
Microvascular complications of diabetes 6 (MVCD6)
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
Iron/manganese superoxide dismutase family
Target Synonyms
Indophenoloxidase B; IPO B; IPOB; Manganese containing superoxide dismutase; Manganese SOD; Manganese superoxide dismutase; Mangano superoxide dismutase; Mn SOD; Mn superoxide dismutase; MNSOD; MVCD6; SOD 2; SOD2; SODM_HUMAN; Superoxide dismutase [Mn] mitochondrial; Superoxide dismutase [Mn], mitochondrial; Superoxide dismutase 2 mitochondrial
Target Background
This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 1.
Notification