-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SOD3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 19-160 of human SOD3 (NP_003093.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against SOD3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 19-160 of human SOD3 (NP_003093.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12637A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SOD3 |
| Target Synonyms | EC-SOD; SOD3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 22Rv1, HL-60, Mouse lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 19-160 of human SOD3 (NP_003093.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGALHAACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPHPQHPGDFGNFAVRDGSLWRYR | Uniprot ID | P08294 |
Uniprot Id
P08294
Target Species
Human
Target Name
SOD3
Target Full Name
Extracellular superoxide dismutase [Cu-Zn]
Target Function
Protect the extracellular space from toxic effect of reactive oxygen intermediates by converting superoxide radicals into hydrogen peroxide and oxygen.
Target Subcellular Location
Secreted, extracellular space. Golgi apparatus, trans-Golgi network. Note=99% of EC-SOD is anchored to heparan sulfate proteoglycans in the tissue interstitium, and 1% is located in the vasculature in equilibrium between the plasma and the endothelium.
Target Protein Families
Cu-Zn superoxide dismutase family
Target Tissue Specificity
Expressed in blood vessels, heart, lung, kidney and placenta. Major SOD isoenzyme in extracellular fluids such as plasma, lymph and synovial fluid.
Target Research Area
Cell Biology
Target Synonyms
EC SOD; EC-SOD; Extracellular superoxide dismutase [Cu Zn]; Extracellular superoxide dismutase [Cu-Zn]; Extracellular superoxide dismutase; Extracellular superoxide dismutase precursor; MGC20077; SOD 3; SOD3; SODE_HUMAN; Superoxide Dismutase 3; Superoxide dismutase 3 extracellular
Target Background
This gene encodes a member of the superoxide dismutase (SOD) protein family. SODs are antioxidant enzymes that catalyze the conversion of superoxide radicals into hydrogen peroxide and oxygen, which may protect the brain, lungs, and other tissues from oxidative stress. Proteolytic processing of the encoded protein results in the formation of two distinct homotetramers that differ in their ability to interact with the extracellular matrix (ECM). Homotetramers consisting of the intact protein, or type C subunit, exhibit high affinity for heparin and are anchored to the ECM. Homotetramers consisting of a proteolytically cleaved form of the protein, or type A subunit, exhibit low affinity for heparin and do not interact with the ECM. A mutation in this gene may be associated with increased heart disease risk.
Notification