Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SOGA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 650-750 of human SOGA1 (NP_542194.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SOGA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 650-750 of human SOGA1 (NP_542194.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08715A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SOGA1 |
| Target Synonyms | SOGA; KIAA0889; C20orf117; SOGA1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse liver, Mouse lung, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 650-750 of human SOGA1 (NP_542194.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AEVLPGLREQAALVSKAIDVLVADANGFTAGLRLCLDNECADFRLHEAPDNSEGPRDTKLIHAILVRLSVLQQELNAFTRKADAVLGCSVKEQQESFSSLP | Uniprot ID | O94964 |
Uniprot Id
O94964
Target Species
Human
Target Name
MTCL2
Target Full Name
Microtubule cross-linking factor 2
Target Function
Regulates autophagy by playing a role in the reduction of glucose production in an adiponectin- and insulin-dependent manner.
Target Subcellular Location
[C-terminal 80 kDa form]: Secreted.
Target Protein Families
SOGA family
Target Synonyms
C20orf117; CT117_HUMAN; dJ132F21.1; FLJ44670; hypothetical protein LOC140710; KIAA0889; protein SOGA1; SOGA; SOGA family member 1; Suppressor of glucose autophagy-associated protein 1; Suppressor of glucose by autophagy; suppressor of glucose from autophagy; Uncharacterized protein C20orf117
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
