-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Somatostatin Receptor 2 (SSTR2) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 270-369 of human Somatostatin Receptor 2 (SSTR2) (NP_001041.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Somatostatin Receptor 2 (SSTR2) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 270-369 of human Somatostatin Receptor 2 (SSTR2) (NP_001041.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04172A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Somatostatin Receptor 2 (SSTR2) |
| Target Synonyms | SST2; Somatostatin Receptor 2 (SSTR2) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, MCF7, MDA-MB-231, Mouse thymus, Neuro-2a, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 270-369 of human Somatostatin Receptor 2 (SSTR2) (NP_001041.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI | Uniprot ID | P30874 |
Uniprot Id
P30874
Target Species
Human
Target Name
SSTR2
Target Full Name
Somatostatin receptor type 2
Target Function
Receptor for somatostatin-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and PLC via pertussis toxin insensitive as well as sensitive G proteins. Inhibits calcium entry by suppressing voltage-dependent calcium channels. Acts as the functionally dominant somatostatin receptor in pancreatic alpha- and beta-cells where it mediates the inhibitory effect of somatostatin-14 on hormone secretion. Inhibits cell growth through enhancement of MAPK1 and MAPK2 phosphorylation and subsequent up-regulation of CDKN1B. Stimulates neuronal migration and axon outgrowth and may participate in neuron development and maturation during brain development. Mediates negative regulation of insulin receptor signaling through PTPN6. Inactivates SSTR3 receptor function following heterodimerization.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasm. Note=Located mainly at the cell surface under basal conditions. Agonist stimulation results in internalization to the cytoplasm.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Expressed in both pancreatic alpha- and beta-cells (at protein level). Expressed at higher levels in the pancreas than other somatostatin receptors. Also expressed in the cerebrum and kidney and, in lesser amounts, in the jejunum, colon and liver. In the
Target Synonyms
SSTR2; Somatostatin receptor type 2; SS-2-R; SS2-R; SS2R; SRIF-1
Target Background
Somatostatin acts at many sites to inhibit the release of many hormones and other secretory proteins. The biologic effects of somatostatin are probably mediated by a family of G protein-coupled receptors that are expressed in a tissue-specific manner. SSTR2 is a member of the superfamily of receptors having seven transmembrane segments and is expressed in highest levels in cerebrum and kidney.
Notification