-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Sorbitol Dehydrogenase was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Sorbitol Dehydrogenase (NP_003095.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Sorbitol Dehydrogenase was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Sorbitol Dehydrogenase (NP_003095.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14686A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Sorbitol Dehydrogenase |
| Target Synonyms | RDH; SDH; XDH; SORD1; SORDD; HEL-S-95n; Sorbitol Dehydrogenase | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, HT-29, Mouse liver, Rat kidney, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Sorbitol Dehydrogenase (NP_003095.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQV | Uniprot ID | Q00796 |
Uniprot Id
Q00796
Target Species
Human
Target Name
SORD
Target Full Name
Sorbitol dehydrogenase
Target Function
Polyol dehydrogenase that catalyzes the reversible NAD(+)-dependent oxidation of various sugar alcohols. Is mostly active with D-sorbitol (D-glucitol), L-threitol, xylitol and ribitol as substrates, leading to the C2-oxidized products D-fructose, L-erythrulose, D-xylulose, and D-ribulose, respectively. Is a key enzyme in the polyol pathway that interconverts glucose and fructose via sorbitol, which constitutes an important alternate route for glucose metabolism. The polyol pathway is believed to be involved in the etiology of diabetic complications, such as diabetic neuropathy and retinopathy, induced by hyperglycemia. May play a role in sperm motility by using sorbitol as an alternative energy source for sperm motility. May have a more general function in the metabolism of secondary alcohols since it also catalyzes the stereospecific oxidation of (2R,3R)-2,3-butanediol. To a lesser extent, can also oxidize L-arabinitol, galactitol and D-mannitol and glycerol in vitro. Oxidizes neither ethanol nor other primary alcohols. Cannot use NADP(+) as the electron acceptor.
Target Subcellular Location
Mitochondrion membrane; Peripheral membrane protein. Cell projection, cilium, flagellum.
Target Protein Families
Zinc-containing alcohol dehydrogenase family
Target Tissue Specificity
Expressed in liver. Expressed in kidney and epithelial cells of both benign and malignant prostate tissue. Expressed in epididymis (at protein level).
Target Synonyms
DHSO_HUMAN; L iditol 2 dehydrogenase; L-iditol 2-dehydrogenase; OTTHUMP00000161939; SDH; Sorbitol dehydrogenase 1; Sorbitol dehydrogenase; SORD 1; SORD; SORD1
Target Background
Sorbitol dehydrogenase (SORD; EC 1.1.1.14) catalyzes the interconversion of polyols and their corresponding ketoses, and together with aldose reductase (ALDR1; MIM 103880), makes up the sorbitol pathway that is believed to play an important role in the development of diabetic complications (summarized by Carr and Markham, 1995 [PubMed 8535074]). The first reaction of the pathway (also called the polyol pathway) is the reduction of glucose to sorbitol by ALDR1 with NADPH as the cofactor. SORD then oxidizes the sorbitol to fructose using NAD(+) cofactor.
Notification