Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SOX1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 292-391 of human SOX1 (NP_005977.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SOX1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 292-391 of human SOX1 (NP_005977.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04188A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SOX1 |
| Target Synonyms | SOX1; SRY-box 1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Rat ovary | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 292-391 of human SOX1 (NP_005977.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HQNSAVAAAAAAAAASSGALGALGSLVKSEPSGSPPAPAHSRAPCPGDLREMISMYLPAGEGGDPAAAAAAAAQSRLHSLPQHYQGAGAGVNGTVPLTHI | Uniprot ID | O00570 |
Uniprot Id
O00570
Target Species
Human
Target Name
SOX1
Target Full Name
Transcription factor SOX-1
Target Function
Transcriptional activator. May function as a switch in neuronal development. Keeps neural cells undifferentiated by counteracting the activity of proneural proteins and suppresses neuronal differentiation.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Mainly expressed in the developing central nervous system.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Sex determining region Y box 1; sox1; SOX1_HUMAN; SRY; SRY box containing gene 1; SRY related HMG box gene 1; Transcription factor Sox-1
Target Background
This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. In mice, a similar protein regulates the gamma-crystallin genes and is essential for lens development.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
