-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SOX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human SOX2 (NP_003097.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against SOX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human SOX2 (NP_003097.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-13032A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SOX2 |
| Target Synonyms | ANOP3; MCOPS3; SOX2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, MCF7, Mouse lung | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human SOX2 (NP_003097.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMA | Uniprot ID | P48431 |
Uniprot Id
P48431
Target Species
Human
Target Name
SOX2
Target Full Name
Transcription factor SOX-2
Target Function
Transcription factor that forms a trimeric complex with OCT4 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Binds to the proximal enhancer region of NANOG. Critical for early embryogenesis and for embryonic stem cell pluripotency. Downstream SRRT target that mediates the promotion of neural stem cell self-renewal. Keeps neural cells undifferentiated by counteracting the activity of proneural proteins and suppresses neuronal differentiation. May function as a switch in neuronal development.
Target Involvement
Microphthalmia, syndromic, 3 (MCOPS3)
Target Subcellular Location
Nucleus.
Target Research Area
Transcription
Target Synonyms
ANOP3; cb236; Delta EF2a; lcc; MCOPS3; MGC148683; MGC2413; RGD1565646; Sex determining region Y box 2; SOX 2; Sox2; SOX2_HUMAN; SRY (sex determining region Y) box 2; SRY box containing gene 2; SRY related HMG box 2; SRY related HMG box gene 2; SRY-box 2; Transcription factor SOX 2; Transcription factor SOX-2; ysb
Target Background
This intronless gene encodes a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The product of this gene is required for stem-cell maintenance in the central nervous system, and also regulates gene expression in the stomach. Mutations in this gene have been associated with optic nerve hypoplasia and with syndromic microphthalmia, a severe form of structural eye malformation. This gene lies within an intron of another gene called SOX2 overlapping transcript (SOX2OT).
Notification