-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SOX6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-74 of human SOX6 (NP_001139291.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SOX6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-74 of human SOX6 (NP_001139291.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09374A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SOX6 |
| Target Synonyms | SOXD; HSSOX6; TOLCAS; SOX6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, HT-29, Jurkat, Mouse skeletal muscle, Rat kidney, Rat skeletal muscle, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-74 of human SOX6 (NP_001139291.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKGHGELQGHERRMSSKQATSPFACAADGEDAMTQDLTSREKEEGSDQHVASHLPLHPIMHNKPHSEELPTLVS | Uniprot ID | P35712 |
Uniprot Id
P35712
Target Species
Human
Target Name
SOX6
Target Full Name
Transcription factor SOX-6
Target Function
Transcription factor that plays a key role in several developmental processes, including neurogenesis, chondrocytes differentiation and cartilage formation. Specifically binds the 5'-AACAAT-3' DNA motif present in enhancers and super-enhancers and promotes expression of genes important for chondrogenesis. Required for overt chondrogenesis when condensed prechondrocytes differentiate into early stage chondrocytes: SOX5 and SOX6 cooperatively bind with SOX9 on active enhancers and super-enhancers associated with cartilage-specific genes, and thereby potentiate SOX9's ability to transactivate. Not involved in precartilaginous condensation, the first step in chondrogenesis, during which skeletal progenitors differentiate into prechondrocytes. Together with SOX5, required to form and maintain a pool of highly proliferating chondroblasts between epiphyses and metaphyses, to form columnar chondroblasts, delay chondrocyte prehypertrophy but promote hypertrophy, and to delay terminal differentiation of chondrocytes on contact with ossification fronts. Binds to the proximal promoter region of the myelin protein MPZ gene, and is thereby involved in the differentiation of oligodendroglia in the developing spinal tube. Binds to the gene promoter of MBP and acts as a transcriptional repressor.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Tissue Specificity
Expressed in a wide variety of tissues, most abundantly in skeletal musclen.
Target Synonyms
HSSOX 6; HSSOX6; SOX 6; sox6; SOX6_HUMAN; SOXD; SRY (sex determining region Y) box 6; SRY box 6; SRY box containing gene 6; Transcription factor SOX 6; Transcription factor Sox-6; Transcription factor SOX6
Target Background
This gene encodes a member of the D subfamily of sex determining region y-related transcription factors that are characterized by a conserved DNA-binding domain termed the high mobility group box and by their ability to bind the minor groove of DNA. The encoded protein is a transcriptional activator that is required for normal development of the central nervous system, chondrogenesis and maintenance of cardiac and skeletal muscle cells. The encoded protein interacts with other family members to cooperatively activate gene expression. Alternative splicing results in multiple transcript variants.
Notification