Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SP140 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SP140 (NP_001265380) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SP140 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SP140 (NP_001265380) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10514A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SP140 |
| Target Synonyms | LYSP100; LYSP100-A; LYSP100-B; SP140 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen, Mouse thymus, Rat thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SP140 (NP_001265380). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAQQGQQGQMASGDSNLNFRMVAEIQNVEGQNLQEQVCPEPIFRFFRENKVEIASAITRPFPFLMGLRDRSFISEQMYEHFQEAFRNLVPVTRVMYCVLSELEKTFGWSHLEALFSRINLMAYPDLNEIYRSFQNVCYEHSPLQMNNVNDLEDRPRLLPYGKQENSNACHEMDDIAVPQE | Uniprot ID | Q13342 |
Uniprot Id
Q13342
Target Species
Human
Target Name
SP140
Target Full Name
Nuclear body protein SP140
Target Function
Component of the nuclear body, also known as nuclear domain 10, PML oncogenic domain, and KR body. May be involved in the pathogenesis of acute promyelocytic leukemia and viral infection. May play a role in chromatin-mediated regulation of gene expression although it does not bind to histone H3 tails.
Target Subcellular Location
Nucleus. Nucleus, PML body. Cytoplasm.
Target Tissue Specificity
High levels in spleen and peripheral blood leukocytes, much lower levels in tonsils, thymus, prostate, ovary, small intestine, and colon Very low levels in heart, brain, placenta, lung, liver, skeletal muscle, kidney, and pancreas. Not detected in brain,
Target Synonyms
LY10_HUMAN; Lymphoid restricted homolog of Sp100; Lymphoid specific SP100 homolog; Lymphoid-restricted homolog of Sp100; LYSP100 A; LYSp100; LYSP100 B; LYSp100 protein; LYSP100-A; LYSP100-B; LYSP100A; LYSP100B; MGC126440; Nuclear antigen Sp140; Nuclear autoantigen Sp-140; Nuclear autoantigen Sp140; Nuclear body protein SP140; SP140; SP140 nuclear body protein; SP140 PEN; Speckled 140 kDa
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
