-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 705-781 of human SP3 (NP_003102.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 705-781 of human SP3 (NP_003102.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-09548A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SP3 |
| Target Synonyms | SPR2; SP3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Mouse brain, Mouse liver, PC-3, Rat testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 705-781 of human SP3 (NP_003102.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NKKGIHSSSTVLASVEAARDDTLITAGGTTLILANIQQGSVSGIGTVNTSATSNQDILTNTEIPLQLVTVSGNETME | Uniprot ID | Q02447 |
Uniprot Id
Q02447
Target Species
Human
Target Name
SP3
Target Full Name
Transcription factor Sp3
Target Function
Transcriptional factor that can act as an activator or repressor depending on isoform and/or post-translational modifications. Binds to GT and GC boxes promoter elements. Competes with SP1 for the GC-box promoters. Weak activator of transcription but can activate a number of genes involved in different processes such as cell-cycle regulation, hormone-induction and house-keeping.
Target Subcellular Location
Nucleus. Nucleus, PML body. Note=Localizes to the nuclear periphery and in nuclear dots when sumoylated. Some localization in PML nuclear bodies.
Target Protein Families
Sp1 C2H2-type zinc-finger protein family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
SPR2; SP3
Target Background
This gene belongs to a family of Sp1 related genes that encode transcription factors that regulate transcription by binding to consensus GC- and GT-box regulatory elements in target genes. This protein contains a zinc finger DNA-binding domain and several transactivation domains, and has been reported to function as a bifunctional transcription factor that either stimulates or represses the transcription of numerous genes. Transcript variants encoding different isoforms have been described for this gene, and one has been reported to initiate translation from a non-AUG (AUA) start codon. Additional isoforms, resulting from the use of alternate downstream translation initiation sites, have also been noted. A related pseudogene has been identified on chromosome 13.
Notification