Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SPA17 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-151 of human SPA17 (NP_059121.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SPA17 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-151 of human SPA17 (NP_059121.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03898A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SPA17 |
| Target Synonyms | CT22; SP17; SP17-1; SPA17 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse lung, Mouse testis, Rat lung, Rat testis, SW480, THP-1, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-151 of human SPA17 (NP_059121.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEENK | Uniprot ID | Q15506 |
Uniprot Id
Q15506
Target Species
Human
Target Name
SPA17
Target Full Name
Sperm surface protein Sp17
Target Function
Sperm surface zona pellucida binding protein. Helps to bind spermatozoa to the zona pellucida with high affinity. Might function in binding zona pellucida and carbohydrates.
Target Subcellular Location
Membrane; Peripheral membrane protein.
Target Tissue Specificity
Testis and sperm specific.
Target Research Area
Cancer
Target Synonyms
Band 34; Cancer/testis antigen 22; CT22; SP17 1; Sp17-1; SP17_HUMAN; SPA17; Sperm autoantigenic protein 17; Sperm protein 17; Sperm surface protein Sp17
Target Background
This gene encodes a protein present at the cell surface. The N-terminus has sequence similarity to human cAMP-dependent protein kinase A (PKA) type II alpha regulatory subunit (RIIa) while the C-terminus has an IQ calmodulin-binding motif. The central portion of the protein has carbohydrate binding motifs and likely functions in cell-cell adhesion. The protein was initially characterized by its involvement in the binding of sperm to the zona pellucida of the oocyte. Recent studies indicate that it is also involved in additional cell-cell adhesion functions such as immune cell migration and metastasis. A retrotransposed pseudogene is present on chromosome 10q22.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
