-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SPAG6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-290 of human SPAG6 (NP_758442.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SPAG6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-290 of human SPAG6 (NP_758442.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04187A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SPAG6 |
| Target Synonyms | pf16; CT141; FAP194; CFAP194; Repro-SA-1; SPAG6 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, PC-3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 180-290 of human SPAG6 (NP_758442.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EIALKRIAASALSDIAKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNASTLIREIAKHTPELSQLVV | Uniprot ID | O75602 |
Uniprot Id
O75602
Target Species
Human
Target Name
SPAG6
Target Full Name
Sperm-associated antigen 6
Target Function
Important for structural integrity of the central apparatus in the sperm tail and for flagellar motility.
Target Subcellular Location
Cytoplasm, cytoskeleton. Cell projection, cilium, flagellum. Cytoplasm, cytoskeleton, cilium axoneme.
Target Tissue Specificity
Highly expressed in testis.
Target Synonyms
axoneme central apparatus protein; DKFZp434I153; MGC26276; PF16; PF16 protein homolog; Protein PF16 homolog; Repro SA 1; Repro-SA-1; SPAG6; SPAG6_HUMAN; Sperm associated antigen 6; Sperm flagellar protein; Sperm-associated antigen 6
Target Background
The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein expressed by this gene is recognized by anti-sperm antibodies from an infertile man. This protein localizes to the tail of permeabilized human sperm and contains eight contiguous armadillo repeats, a motif known to mediate protein-protein interactions. Studies in mice suggest that this protein is involved in sperm flagellar motility and maintenance of the structural integrity of mature sperm. Several transcript variants encoding different isoforms have been found for this gene.
Notification