-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SPAM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 61-223 of human SPAM1 (NP_694859.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SPAM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 61-223 of human SPAM1 (NP_694859.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14801A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SPAM1 |
| Target Synonyms | HYA1; PH20; HYAL1; HYAL3; HYAL5; PH-20; SPAG15; HEL-S-96n; SPAM1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 61-223 of human SPAM1 (NP_694859.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LGKFDEPLDMSLFSFIGSPRINATGQGVTIFYVDRLGYYPYIDSITGVTVNGGIPQKISLQDHLDKAKKDITFYMPVDNLGMAVIDWEEWRPTWARNWKPKDVYKNRSIELVQQQNVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLLRPNHLWGYYLFPD | Uniprot ID | P38567 |
Uniprot Id
P38567
Target Species
Human
Target Name
SPAM1
Target Full Name
Hyaluronidase PH-20
Target Function
Involved in sperm-egg adhesion. Upon fertilization sperm must first penetrate a layer of cumulus cells that surrounds the egg before reaching the zona pellucida. The cumulus cells are embedded in a matrix containing hyaluronic acid which is formed prior to ovulation. This protein aids in penetrating the layer of cumulus cells by digesting hyaluronic acid.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Target Protein Families
Glycosyl hydrolase 56 family
Target Tissue Specificity
Testis.
Target Research Area
Cancer
Target Synonyms
epididymis secretory sperm binding protein Li 96n; HEL-S-96n; HYA1; HYAL PH-20; HYAL PH20; Hyal-PH20; HYAL1; HYAL3; HYAL5; HYALP_HUMAN; Hyaluronidase PH-20; Hyaluronoglucosaminidase PH-20; MGC26532; PH-20 Hyaluronidase; PH20; PH20 Hyaluronidase; SPAG15; SPAM-1; Spam1; sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding); Sperm adhesion molecule 1; Sperm surface protein PH-20; Sperm surface protein PH20; zona pellucida binding
Target Background
Hyaluronidase degrades hyaluronic acid, a major structural proteoglycan found in extracellular matrices and basement membranes. Six members of the hyaluronidase family are clustered into two tightly linked groups on chromosome 3p21.3 and 7q31.3. This gene was previously referred to as HYAL1 and HYA1 and has since been assigned the official symbol SPAM1; another family member on chromosome 3p21.3 has been assigned HYAL1. This gene encodes a GPI-anchored enzyme located on the human sperm surface and inner acrosomal membrane. This multifunctional protein is a hyaluronidase that enables sperm to penetrate through the hyaluronic acid-rich cumulus cell layer surrounding the oocyte, a receptor that plays a role in hyaluronic acid induced cell signaling, and a receptor that is involved in sperm-zona pellucida adhesion. Abnormal expression of this gene in tumors has implicated this protein in degradation of basement membranes leading to tumor invasion and metastasis. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification