Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SPATA5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 228-304 of human SPATA5 (NP_001304728) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SPATA5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 228-304 of human SPATA5 (NP_001304728) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07469A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SPATA5 |
| Target Synonyms | AFG2; SPAF; EHLMRS; NEDHSB; SPATA5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse pancreas, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 228-304 of human SPATA5 (NP_001304728). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LELSLQLSQLDLEDTQIPTSRSTPYKPIDDRITNKASDVLLDVTQSPGDGSGLMLEEVTGLKCNFESAREGNEQLTE | Uniprot ID | Q8NB90 |
Uniprot Id
Q8NB90
Target Species
Human
Target Name
AFG2A
Target Full Name
ATPase family gene 2 protein homolog A
Target Function
ATP-dependent chaperone which uses the energy provided by ATP hydrolysis to generate mechanical force to disassemble protein complexes. May be involved in morphological and functional mitochondrial transformations during spermatogenesis.
Target Involvement
Epilepsy, hearing loss, and mental retardation syndrome (EHLMRS)
Target Subcellular Location
Cytoplasm. Mitochondrion. Cytoplasm, cytoskeleton, spindle.
Target Protein Families
AAA ATPase family, AFG2 subfamily
Target Synonyms
SPATA5; AFG2; SPAF; ATPase family protein 2 homolog; EC 3.6.4.10; Spermatogenesis-associated factor protein; Spermatogenesis-associated protein 5
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
